PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do009338.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family bZIP
Protein Properties Length: 391aa    MW: 41436.5 Da    PI: 6.0207
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do009338.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.43.5e-14315368559
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                 +r+rr++kNRe+A rsR+RK+a++ eLe +   L++eN +Lk e e  +k++++ 
  Do009338.1 315 RRQRRMIKNRESAARSRARKQAYTVELEAELNHLKEENARLKAE-ELVEKMMEQA 368
                 79****************************************55.5666776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.2E-13311373IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.059313358IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.38E-10315358No hitNo description
Gene3DG3DSA:1.20.5.1702.2E-13315372No hitNo description
PfamPF001701.3E-11315369IPR004827Basic-leucine zipper domain
CDDcd147079.35E-25315356No hitNo description
PROSITE patternPS000360318333IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0010152Biological Processpollen maturation
GO:0010187Biological Processnegative regulation of seed germination
GO:0010200Biological Processresponse to chitin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MASEMSKNVK VLDEQEVTSH QRDRARASSA GAAAEEQAAD PLVRQASIMS LTLEELQNSL  60
CEPGRNFGSM NMDEFMANIW NAEEFQAATG GCEEDVEREA AAAATATGAG ENGGGGGGGS  120
GLVRQGSFAL PPPLSRKTVE EVWAEINQGP AAQAHSAPPQ AMVMQPQMGS GGGGVDRQVT  180
LGEMTLEDFL VRAGVVRGGF AGHGQAAGHM PQQGQQLAAP VMYQVAPANP AVYPVMGDGM  240
GYHNGYPGGM AVVPPPPPSQ CVARALSPGS SDGVSAMTQA EMMNCIGNGG MPRNGGNARK  300
RDSPEEGCTE KTVERRQRRM IKNRESAARS RARKQAYTVE LEAELNHLKE ENARLKAEEL  360
VEKMMEQARE NVSAKKKGGR RGLRRCGSAM W
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00294DAPTransfer from AT2G36270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF3147010.0KF314701.1 Setaria italica clone SiABRE hypothetical protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001296980.10.0protein ABSCISIC ACID-INSENSITIVE 5
TrEMBLK3XIK90.0K3XIK9_SETIT; Uncharacterized protein
STRINGSi001731m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38303558
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.19e-38ABA-responsive element binding protein 3